Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (3 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.2: G domain-linked domain [82583] (2 proteins) |
Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species) N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82585] (1 PDB entry) |
Domain d1ni3a2: 1ni3 A:307-388 [80532] Other proteins in same PDB: d1ni3a1 complexed with so4 |
PDB Entry: 1ni3 (more details), 2.8 Å
SCOPe Domain Sequences for d1ni3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} linyftcgedevrswtirkgtkapqaagvihtdfekafvvgeimhyqdlfdyktenacra agkyltkgkeyvmesgdiahwk
Timeline for d1ni3a2: