SCOP 1.63: Domain d1ni3a2: 1ni3 A:307-388

Lineage for d1ni3a2 (1ni3 A:307-388)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (2 families)
   possibly related to the ubiquitin-like and MoaD/ThiS suprfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.2: YchF GTP-binding protein, C-terminal domain [82583] (1 protein)

6. Protein YchF GTP-binding protein, C-terminal domain [82584] (1 species)
   N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82585] (1 PDB entry)

8. Domain d1ni3a2: 1ni3 A:307-388 [80532]
   Other proteins in same PDB: d1ni3a1
   structural genomics protein; complexed with mse, so4

Details for d1ni3a2

PDB Entry: 1ni3, 2.8 Å

PDB Description: structure of the schizosaccharomyces pombe ychf gtpase

SCOP Domain Sequences for d1ni3a2:

Sequence; same for both SEQRES and ATOM records:

>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe)}
linyftcgedevrswtirkgtkapqaagvihtdfekafvvgeimhyqdlfdyktenacra
agkyltkgkeyvmesgdiahwk

Timeline for d1ni3a2:

• d1ni3a2 is new in SCOP 1.63
  
• d1ni3a2 appears in SCOP 1.65
  
• d1ni3a2 appears in the current release, SCOPe 2.08