Lineage for d1nfib_ (1nfi B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 788965Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 788966Species Human (Homo sapiens) [TaxId:9606] [49249] (9 PDB entries)
    Uniprot P25799 245-350
  8. 788976Domain d1nfib_: 1nfi B: [21925]
    Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_

Details for d1nfib_

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex
PDB Compounds: (B:) nf-kappa-b p50

SCOP Domain Sequences for d1nfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfib_ b.1.18.1 (B:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik

SCOP Domain Coordinates for d1nfib_:

Click to download the PDB-style file with coordinates for d1nfib_.
(The format of our PDB-style files is described here.)

Timeline for d1nfib_: