SCOP 1.75: Domain d1nfic2: 1nfi C:20-189

Lineage for d1nfic2 (1nfi C:20-189)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (7 families)
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry)
Domain d1nfic2: 1nfi C:20-189 [22456]
Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_

Details for d1nfic2

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

PDB Compounds: (C:) nf-kappa-b p65

SCOP Domain Sequences for d1nfic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfic2 b.2.5.3 (C:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap

SCOP Domain Coordinates for d1nfic2:

Click to download the PDB-style file with coordinates for d1nfic2.
(The format of our PDB-style files is described here.)

Timeline for d1nfic2: