Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50059] (34 PDB entries) |
Domain d1nega_: 1neg A: [80425] N-and C-terminal labeled protein complexed with azi |
PDB Entry: 1neg (more details), 2.3 Å
SCOPe Domain Sequences for d1nega_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nega_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkklaaaw shpqf
Timeline for d1nega_: