Lineage for d1nega1 (1neg A:6-64)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053739Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2053740Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2053761Domain d1nega1: 1neg A:6-64 [80425]
    Other proteins in same PDB: d1nega2
    N-and C-terminal labeled protein
    complexed with azi

Details for d1nega1

PDB Entry: 1neg (more details), 2.3 Å

PDB Description: crystal structure analysis of n-and c-terminal labeled sh3-domain of alpha-chicken spectrin
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d1nega1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nega1 b.34.2.1 (A:6-64) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkklaaa

SCOPe Domain Coordinates for d1nega1:

Click to download the PDB-style file with coordinates for d1nega1.
(The format of our PDB-style files is described here.)

Timeline for d1nega1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nega2