Lineage for d1ne9a2 (1ne9 A:165-335)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) 
Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (2 proteins)
duplication: consists of two NAT-like domains swapped with the C-terminal strandsProtein Peptidyltransferase FemX [103177] (1 species) Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries) 
Domain d1ne9a2: 1ne9 A:165-335 [91840]
complexed with mg
Details for d1ne9a2
PDB Entry: 1ne9 (more details), 1.7 Å
PDB Description: Crystal Structure of Weissella viridescens FemX at 1.7 Ang Resolution
PDB Compounds: (A:) FemXSCOP Domain Sequences for d1ne9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
ypsktkskikrpfrdgvevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafd
adtmrifvaeregkllstgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtnt
dlydlggiesestddslyvfkhvfvkdapreyigeidkvldpevyaelvkd
SCOP Domain Coordinates for d1ne9a2:
Click to download the PDB-style file with coordinates for d1ne9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ne9a2:
- d1ne9a2 first appeared in SCOP 1.67
- d1ne9a2 appears in SCOP 1.71
- d1ne9a2 appears in SCOP 1.75
- d1ne9a2 appears in the current release, SCOPe 2.08
View in 3D
