Lineage for d1n9mc_ (1n9m C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. Protein Streptavidin [50878] (1 species)
  7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. Domain d1n9mc_: 1n9m C: [91736]
    complexed with btn; mutant

Details for d1n9mc_

PDB Entry: 1n9m (more details), 1.6 Å

PDB Description: streptavidin mutant s27a with biotin at 1.6a resolution
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d1n9mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9mc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkpsaas

SCOPe Domain Coordinates for d1n9mc_ are not available.

Timeline for d1n9mc_:

Domains from other chains:
(mouse over for more information)
d1n9ma_, d1n9mb_, d1n9md_