PDB entry 1n9m

View 1n9m on RCSB PDB site
Description: Streptavidin Mutant S27A with Biotin at 1.6A Resolution
Class: biotin-binding protein
Keywords: homotetramer, BIOTIN-BINDING PROTEIN
Deposited on 2002-11-25, released 2003-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene: core streptavidin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (14)
    Domains in SCOPe 2.08: d1n9ma_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene: core streptavidin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered (14)
    Domains in SCOPe 2.08: d1n9mb_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene: core streptavidin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-126)
      • engineered (14)
    Domains in SCOPe 2.08: d1n9mc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Gene: core streptavidin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered (14)
    Domains in SCOPe 2.08: d1n9md_
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9mA (A:)
    aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9mA (A:)
    eagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9mB (B:)
    aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9mB (B:)
    gitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n9mC (C:)
    aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n9mD (D:)
    aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9mD (D:)
    aeagitgtwynqlgatfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp