Lineage for d1n8qa2 (1n8q A:9-167)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
sandwich; 8 strands in 2 sheets; complex topology
duplication: has weak internal pseudo twofold symmetrySuperfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) 
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) Protein Plant lipoxigenase [49725] (2 species) 
Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (9 PDB entries)
Uniprot P09186
Domain d1n8qa2: 1n8q A:9-167 [85423]
Other proteins in same PDB: d1n8qa1
complexed with dhb, fe2
Details for d1n8qa2
PDB Entry: 1n8q (more details), 2.1 Å
PDB Description: lipoxygenase in complex with protocatechuic acid
PDB Compounds: (A:) lipoxygenase-3SCOPe Domain Sequences for d1n8qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8qa2 b.12.1.1 (A:9-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
sltledipnhgsihfvcnswiynaklfksdriffanqty
SCOPe Domain Coordinates for d1n8qa2:
Click to download the PDB-style file with coordinates for d1n8qa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n8qa2:
- d1n8qa2 first appeared in SCOP 1.65
- d1n8qa2 appears in SCOPe 2.02
- d1n8qa2 appears in SCOPe 2.04
- d1n8qa2 appears in the current release, SCOPe 2.08
View in 3D
