| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Interferon-alpha/beta receptor beta chain [89199] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89200] (5 PDB entries) |
| Domain d1n6va2: 1n6v A:110-210 [85366] Other proteins in same PDB: d1n6va3 |
PDB Entry: 1n6v (more details)
SCOPe Domain Sequences for d1n6va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6va2 b.1.2.1 (A:110-210) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppgqese
Timeline for d1n6va2: