Lineage for d1n1ba1 (1n1b A:64-270)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007408Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2007409Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
    incomplete toroid made of four hairpins
    automatically mapped to Pfam PF01397
  6. 2007410Protein (+)-bornyl diphosphate synthase [81857] (1 species)
  7. 2007411Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)
  8. 2007412Domain d1n1ba1: 1n1b A:64-270 [79799]
    Other proteins in same PDB: d1n1ba2, d1n1bb2
    complexed with hg, mg

Details for d1n1ba1

PDB Entry: 1n1b (more details), 2 Å

PDB Description: crystal structure of (+)-bornyl diphosphate synthase from sage
PDB Compounds: (A:) (+)-bornyl diphosphate synthase

SCOPe Domain Sequences for d1n1ba1:

Sequence, based on SEQRES records: (download)

>d1n1ba1 a.102.4.1 (A:64-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
lwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffq
deikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgidf
kaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllwirh
sldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records): (download)

>d1n1ba1 a.102.4.1 (A:64-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
lwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffq
deikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgidf
kaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkklddenlllwirhsldlpl
hwriqsvearwfidayarrpd

SCOPe Domain Coordinates for d1n1ba1:

Click to download the PDB-style file with coordinates for d1n1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1ba2