Lineage for d1mzgb_ (1mzg B:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.224: SufE/NifU [82648] (1 superfamily)
alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123Superfamily d.224.1: SufE/NifU [82649] (4 families) 
iron-sulfur cluster assembly proteinsFamily d.224.1.1: SufE-like [82650] (3 proteins)
Fe-S metabolism associated domain
Protein SufE (YhnA) [82651] (1 species)
unknown function; probably involved in Fe-S center assemblySpecies Escherichia coli [TaxId:562] [82652] (1 PDB entry) 
Domain d1mzgb_: 1mzg B: [79697]
structural genomics
Details for d1mzgb_
PDB Entry: 1mzg (more details), 2 Å
PDB Description: X-Ray Structure of SufE from E.coli Northeast Structural Genomics (NESG) Consortium Target ER30
PDB Compounds: (B:) SufE ProteinSCOPe Domain Sequences for d1mzgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzgb_ d.224.1.1 (B:) SufE (YhnA) {Escherichia coli [TaxId: 562]}
allpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrq
naqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsq
gleamirairakaaalslehhhh
SCOPe Domain Coordinates for d1mzgb_:
Click to download the PDB-style file with coordinates for d1mzgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mzgb_:
- d1mzgb_ first appeared in SCOP 1.63
- d1mzgb_ appears in SCOPe 2.01
- d1mzgb_ appears in SCOPe 2.03
- d1mzgb_ appears in the current release, SCOPe 2.08, called d1mzgb1
View in 3D
