Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.170: SRCR-like [56486] (2 superfamilies) unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta |
Superfamily d.170.2: A heparin-binding domain [56491] (1 family) automatically mapped to Pfam PF02177 |
Family d.170.2.1: A heparin-binding domain [56492] (2 proteins) |
Protein N-terminal domain of the amyloid precursor protein [56493] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56494] (1 PDB entry) |
Domain d1mwpa_: 1mwp A: [42453] |
PDB Entry: 1mwp (more details), 1.8 Å
SCOPe Domain Sequences for d1mwpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwpa_ d.170.2.1 (A:) N-terminal domain of the amyloid precursor protein {Human (Homo sapiens) [TaxId: 9606]} llaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqitnvve anqpvtiqnwckrgrkqckthphfvipyrclvgefv
Timeline for d1mwpa_: