Lineage for d1mwpa_ (1mwp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608706Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2608745Superfamily d.170.2: A heparin-binding domain [56491] (1 family) (S)
    automatically mapped to Pfam PF02177
  5. 2608746Family d.170.2.1: A heparin-binding domain [56492] (2 proteins)
  6. 2608747Protein N-terminal domain of the amyloid precursor protein [56493] (1 species)
  7. 2608748Species Human (Homo sapiens) [TaxId:9606] [56494] (1 PDB entry)
  8. 2608749Domain d1mwpa_: 1mwp A: [42453]

Details for d1mwpa_

PDB Entry: 1mwp (more details), 1.8 Å

PDB Description: n-terminal domain of the amyloid precursor protein
PDB Compounds: (A:) amyloid a4 protein

SCOPe Domain Sequences for d1mwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwpa_ d.170.2.1 (A:) N-terminal domain of the amyloid precursor protein {Human (Homo sapiens) [TaxId: 9606]}
llaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqitnvve
anqpvtiqnwckrgrkqckthphfvipyrclvgefv

SCOPe Domain Coordinates for d1mwpa_:

Click to download the PDB-style file with coordinates for d1mwpa_.
(The format of our PDB-style files is described here.)

Timeline for d1mwpa_: