Lineage for d1mwma2 (1mwm A:158-320)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857753Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 1857754Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 1857760Domain d1mwma2: 1mwm A:158-320 [79581]
    complexed with adp, mg

Details for d1mwma2

PDB Entry: 1mwm (more details), 2 Å

PDB Description: parm from plasmid r1 adp form
PDB Compounds: (A:) ParM

SCOPe Domain Sequences for d1mwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwma2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

SCOPe Domain Coordinates for d1mwma2:

Click to download the PDB-style file with coordinates for d1mwma2.
(The format of our PDB-style files is described here.)

Timeline for d1mwma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwma1