Lineage for d1moqa_ (1moq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908084Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2908085Protein 'Isomerase domain' of glucosamine 6-phosphate synthase (GLMS) [53699] (2 species)
  7. 2908086Species Escherichia coli [TaxId:562] [53700] (6 PDB entries)
  8. 2908087Domain d1moqa_: 1moq A: [35302]
    complexed with glp, mes, mrd, na, so4

Details for d1moqa_

PDB Entry: 1moq (more details), 1.57 Å

PDB Description: isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate
PDB Compounds: (A:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1moqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moqa_ c.80.1.1 (A:) 'Isomerase domain' of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
gdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacgt
synsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrls
kelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvaklsrl
kgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypialeg
alklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarggq
lyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnla
ksvtve

SCOPe Domain Coordinates for d1moqa_:

Click to download the PDB-style file with coordinates for d1moqa_.
(The format of our PDB-style files is described here.)

Timeline for d1moqa_: