Lineage for d1mkaa_ (1mka A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) 
Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
contains two additional beta-strands in the N-terminal extension
Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species) Species Escherichia coli [TaxId:562] [54643] (4 PDB entries) 
Domain d1mkaa_: 1mka A: [38543]
CASP1
complexed with dac
Details for d1mkaa_
PDB Entry: 1mka (more details), 2 Å
PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine
PDB Compounds: (A:) beta-hydroxydecanoyl thiol ester dehydraseSCOPe Domain Sequences for d1mkaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf
SCOPe Domain Coordinates for d1mkaa_:
Click to download the PDB-style file with coordinates for d1mkaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mkaa_:
- d1mkaa_ first appeared (with stable ids) in SCOP 1.55
- d1mkaa_ appears in SCOPe 2.02
- d1mkaa_ appears in SCOPe 2.04
- d1mkaa_ appears in the current release, SCOPe 2.08
View in 3D
