![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
![]() | Protein Acetylcholinesterase [53476] (6 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [53479] (39 PDB entries) |
![]() | Domain d1maaa_: 1maa A: [34615] complexed with dme, gol, nag, po4 |
PDB Entry: 1maa (more details), 2.9 Å
SCOPe Domain Sequences for d1maaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1maaa_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf artgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
Timeline for d1maaa_: