Class a: All alpha proteins [46456] (289 folds) |
Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins) |
Protein Orange carotenoid protein, N-terminal domain [81932] (1 species) |
Species Arthrospira maxima [TaxId:129910] [81933] (2 PDB entries) |
Domain d1m98a1: 1m98 A:2-175 [78866] Other proteins in same PDB: d1m98a2, d1m98b2 complexed with cl, heq, suc |
PDB Entry: 1m98 (more details), 2.1 Å
SCOPe Domain Sequences for d1m98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m98a1 a.175.1.1 (A:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]} pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva
Timeline for d1m98a1: