Lineage for d1m98a1 (1m98 A:2-175)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
multihelical; arraySuperfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) 
duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
automatically mapped to Pfam PF09150Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins) 
Protein Orange carotenoid protein, N-terminal domain [81932] (1 species) Species Arthrospira maxima [TaxId:129910] [81933] (2 PDB entries) 
Domain d1m98a1: 1m98 A:2-175 [78866]
Other proteins in same PDB: d1m98a2, d1m98b2
complexed with cl, heq, suc
Details for d1m98a1
PDB Entry: 1m98 (more details), 2.1 Å
PDB Description: crystal structure of orange carotenoid protein
PDB Compounds: (A:) Orange Carotenoid ProteinSCOPe Domain Sequences for d1m98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m98a1 a.175.1.1 (A:2-175) Orange carotenoid protein, N-terminal domain {Arthrospira maxima [TaxId: 129910]}
pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrva
SCOPe Domain Coordinates for d1m98a1:
Click to download the PDB-style file with coordinates for d1m98a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m98a1:
- d1m98a1 first appeared in SCOP 1.63
- d1m98a1 appears in SCOPe 2.05
- d1m98a1 does not appear in SCOPe 2.07
View in 3D
