Lineage for d1m8ra_ (1m8r A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505317Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1505318Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1505323Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1505431Protein Snake phospholipase A2 [48624] (36 species)
  7. 1505482Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 1505484Domain d1m8ra_: 1m8r A: [78812]
    complexed with bu1, cd

Details for d1m8ra_

PDB Entry: 1m8r (more details), 1.9 Å

PDB Description: Crystal Structures of Cadmium-binding Acidic Phospholipase A2 from the Venom of Agkistrodon halys pallas at 1.9 Resolution (crystal grown at pH 7.4)
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1m8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
slvqfetlimkvakksgmqwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
mdvysfseengdivcggddpckkeicecdraaaicfrdnlntyndkkywafgakncpqee
sepc

SCOPe Domain Coordinates for d1m8ra_:

Click to download the PDB-style file with coordinates for d1m8ra_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ra_: