Lineage for d1m42a_ (1m42 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770970Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
    automatically mapped to Pfam PF04234
    automatically mapped to Pfam PF13205
  6. 1770971Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)
  7. 1770977Species Pseudomonas syringae [TaxId:317] [81971] (4 PDB entries)
  8. 1770980Domain d1m42a_: 1m42 A: [78597]

Details for d1m42a_

PDB Entry: 1m42 (more details)

PDB Description: solution structure of apocopc from pseudomonas syringae
PDB Compounds: (A:) copper resistance protein c

SCOPe Domain Sequences for d1m42a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m42a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

SCOPe Domain Coordinates for d1m42a_:

Click to download the PDB-style file with coordinates for d1m42a_.
(The format of our PDB-style files is described here.)

Timeline for d1m42a_: