Lineage for d1m18f_ (1m18 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725987Protein Histone H4 [47125] (7 species)
  7. 1725988Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries)
  8. 1726003Domain d1m18f_: 1m18 F: [78376]
    Other proteins in same PDB: d1m18a_, d1m18c_, d1m18d_, d1m18e_, d1m18g_, d1m18h_
    protein/DNA complex; complexed with 1sz, mn

Details for d1m18f_

PDB Entry: 1m18 (more details), 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d1m18f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m18f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1m18f_:

Click to download the PDB-style file with coordinates for d1m18f_.
(The format of our PDB-style files is described here.)

Timeline for d1m18f_: