Lineage for d1lzwa_ (1lzw A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904037Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 1904038Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 1904062Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 1904063Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 1904064Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)
  8. 1904081Domain d1lzwa_: 1lzw A: [78312]
    Other proteins in same PDB: d1lzwb_
    complex with ClpA N-domain
    complexed with pt

Details for d1lzwa_

PDB Entry: 1lzw (more details), 2.5 Å

PDB Description: structural basis of clps-mediated switch in clpa substrate recognition
PDB Compounds: (A:) Protein yljA

SCOPe Domain Sequences for d1lzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lzwa_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
ftaevaetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1lzwa_:

Click to download the PDB-style file with coordinates for d1lzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1lzwa_: