Lineage for d1lzwa_ (1lzw A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)
  8. Domain d1lzwa_: 1lzw A: [78312]
    Other proteins in same PDB: d1lzwb_
    complex with ClpA N-domain
    complexed with pt

Details for d1lzwa_

PDB Entry: 1lzw (more details), 2.5 Å

PDB Description: structural basis of clps-mediated switch in clpa substrate recognition
PDB Compounds: (A:) Protein yljA

SCOPe Domain Sequences for d1lzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lzwa_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
ftaevaetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1lzwa_ are not available.

Timeline for d1lzwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lzwb_