Lineage for d1lyva_ (1lyv A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991569Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 991570Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 991642Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 991647Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species)
  7. 991648Species Yersinia enterocolitica [TaxId:630] [52812] (11 PDB entries)
  8. 991649Domain d1lyva_: 1lyv A: [74348]
    complexed with cl, po4; mutant

Details for d1lyva_

PDB Entry: 1lyv (more details), 1.36 Å

PDB Description: high-resolution structure of the catalytically inactive yersinia tyrosine phosphatase c403a mutant in complex with phosphate.
PDB Compounds: (A:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d1lyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrns
qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d1lyva_:

Click to download the PDB-style file with coordinates for d1lyva_.
(The format of our PDB-style files is described here.)

Timeline for d1lyva_: