Lineage for d1ls6a_ (1ls6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866455Protein Aryl sulfotransferase sult1a [102346] (1 species)
  7. 2866456Species Human (Homo sapiens) [TaxId:9606] [102347] (2 PDB entries)
  8. 2866457Domain d1ls6a_: 1ls6 A: [91115]
    complexed with a3p, npo

Details for d1ls6a_

PDB Entry: 1ls6 (more details), 1.9 Å

PDB Description: Human SULT1A1 complexed with PAP and p-Nitrophenol
PDB Compounds: (A:) aryl sulfotransferase

SCOPe Domain Sequences for d1ls6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOPe Domain Coordinates for d1ls6a_:

Click to download the PDB-style file with coordinates for d1ls6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ls6a_: