![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (6 PDB entries) |
![]() | Domain d1lqba_: 1lqb A: [74184] Other proteins in same PDB: d1lqbb_, d1lqbc_ complexed with so4 |
PDB Entry: 1lqb (more details), 2 Å
SCOPe Domain Sequences for d1lqba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqba_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
Timeline for d1lqba_: