Lineage for d1lnia_ (1lni A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923948Protein RNase Sa [53935] (1 species)
  7. 2923949Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 2923957Domain d1lnia_: 1lni A: [74046]
    complexed with gol, so4

Details for d1lnia_

PDB Entry: 1lni (more details), 1 Å

PDB Description: crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic resolution (1.0 a)
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1lnia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnia_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d1lnia_:

Click to download the PDB-style file with coordinates for d1lnia_.
(The format of our PDB-style files is described here.)

Timeline for d1lnia_: