Lineage for d1lnia_ (1lni A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187025Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 187026Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 187027Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 187154Protein RNase Sa [53935] (1 species)
  7. 187155Species Streptomyces aureofaciens [TaxId:1894] [53936] (16 PDB entries)
  8. 187156Domain d1lnia_: 1lni A: [74046]

Details for d1lnia_

PDB Entry: 1lni (more details), 1 Å

PDB Description: crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic resolution (1.0 a)

SCOP Domain Sequences for d1lnia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnia_ d.1.1.1 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1lnia_:

Click to download the PDB-style file with coordinates for d1lnia_.
(The format of our PDB-style files is described here.)

Timeline for d1lnia_: