Lineage for d1leha2 (1leh A:1-134)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Leucine dehydrogenase [53231] (1 species) Species Bacillus sphaericus [TaxId:1421] [53232] (1 PDB entry) 
Domain d1leha2: 1leh A:1-134 [33916]
Other proteins in same PDB: d1leha1, d1lehb1
Details for d1leha2
PDB Entry: 1leh (more details), 2.2 Å
PDB Description: leucine dehydrogenase from bacillus sphaericus
PDB Compounds: (A:) leucine dehydrogenaseSCOPe Domain Sequences for d1leha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]}
meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr
largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv
ddmdlihqetdyvt
SCOPe Domain Coordinates for d1leha2:
Click to download the PDB-style file with coordinates for d1leha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1leha2:
- d1leha2 first appeared (with stable ids) in SCOP 1.55
- d1leha2 appears in SCOPe 2.04
- d1leha2 appears in SCOPe 2.06
- d1leha2 appears in the current release, SCOPe 2.08
View in 3D
