Lineage for d1leha2 (1leh A:1-134)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25653Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 25711Protein Leucine dehydrogenase [53231] (1 species)
  7. 25712Species Bacillus sphaericus [TaxId:1421] [53232] (1 PDB entry)
  8. 25713Domain d1leha2: 1leh A:1-134 [33916]
    Other proteins in same PDB: d1leha1, d1lehb1

Details for d1leha2

PDB Entry: 1leh (more details), 2.2 Å

PDB Description: leucine dehydrogenase from bacillus sphaericus

SCOP Domain Sequences for d1leha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus}
meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr
largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv
ddmdlihqetdyvt

SCOP Domain Coordinates for d1leha2:

Click to download the PDB-style file with coordinates for d1leha2.
(The format of our PDB-style files is described here.)

Timeline for d1leha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1leha1