Lineage for d1lbva_ (1lbv A:)
- Root: SCOPe 2.07
Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) 
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheetSuperfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) 
Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) 
Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (5 species) 
Species Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries) 
Domain d1lbva_: 1lbv A: [73813]
Details for d1lbva_
PDB Entry: 1lbv (more details), 1.8 Å
PDB Description: Crystal Structure of apo-form (P21) of dual activity FBPase/IMPase (AF2372) from Archaeoglobus fulgidus
PDB Compounds: (A:) fructose 1,6-bisphosphatase/inositol monophosphataseSCOPe Domain Sequences for d1lbva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 2234]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik
SCOPe Domain Coordinates for d1lbva_:
Click to download the PDB-style file with coordinates for d1lbva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lbva_:
- d1lbva_ first appeared in SCOP 1.61
- d1lbva_ appears in SCOPe 2.06
- d1lbva_ appears in the current release, SCOPe 2.08
View in 3D
