Lineage for d1lama1 (1lam A:160-484)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loopsSuperfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) 
core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins)
automatically mapped to Pfam PF00883Protein Leucine aminopeptidase, C-terminal domain [53202] (2 species) Species Cow (Bos taurus) [TaxId:9913] [53203] (7 PDB entries) 
Domain d1lama1: 1lam A:160-484 [33829]
Other proteins in same PDB: d1lama2
complexed with co3, mrd, zn
Details for d1lama1
PDB Entry: 1lam (more details), 1.6 Å
PDB Description: leucine aminopeptidase (unligated)
PDB Compounds: (A:) leucine aminopeptidaseSCOPe Domain Sequences for d1lama1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lama1 c.56.5.3 (A:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsq
SCOPe Domain Coordinates for d1lama1:
Click to download the PDB-style file with coordinates for d1lama1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lama1:
- d1lama1 first appeared (with stable ids) in SCOP 1.55, called d1lam_2
- d1lama1 appears in SCOPe 2.06
- d1lama1 appears in the current release, SCOPe 2.08
View in 3D
