Lineage for d1l9la_ (1l9l A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771691Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 771692Superfamily a.64.1: Saposin [47862] (4 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 771693Family a.64.1.1: NKL-like [47863] (3 proteins)
  6. 771694Protein Granulysin, NKG5 protein [81809] (1 species)
  7. 771695Species Human (Homo sapiens) [TaxId:9606] [81810] (1 PDB entry)
  8. 771696Domain d1l9la_: 1l9l A: [77827]
    complexed with eoh, mpo, so4

Details for d1l9la_

PDB Entry: 1l9l (more details), 0.92 Å

PDB Description: granulysin from human cytolytic t lymphocytes
PDB Compounds: (A:) Granulysin

SCOP Domain Sequences for d1l9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]}
grdyrtcltivqklkkmvdkptqrsvsnaatrvcrtgrsrwrdvcrnfmrryqsrviqgl
vagetaqqicedlr

SCOP Domain Coordinates for d1l9la_:

Click to download the PDB-style file with coordinates for d1l9la_.
(The format of our PDB-style files is described here.)

Timeline for d1l9la_: