| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (4 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
| Family a.64.1.1: NKL-like [47863] (3 proteins) |
| Protein Granulysin, NKG5 protein [81809] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81810] (1 PDB entry) |
| Domain d1l9la_: 1l9l A: [77827] complexed with eoh, mpo, so4 |
PDB Entry: 1l9l (more details), 0.92 Å
SCOP Domain Sequences for d1l9la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]}
grdyrtcltivqklkkmvdkptqrsvsnaatrvcrtgrsrwrdvcrnfmrryqsrviqgl
vagetaqqicedlr
Timeline for d1l9la_: