PDB entry 1l9l

View 1l9l on RCSB PDB site
Description: granulysin from human cytolytic t lymphocytes
Class: antimicrobial protein
Keywords: granulysin, saposin fold, membrane-lytic
Deposited on 2002-03-25, released 2002-11-06
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.138
AEROSPACI score: 1.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Granulysin
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22749 (0-73)
  Domains in SCOP 1.75: d1l9la_
• Heterogens: SO4, MPO, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l9lA (A:)
  grdyrtcltivqklkkmvdkptqrsvsnaatrvcrtgrsrwrdvcrnfmrryqsrviqgl
  vagetaqqicedlr