Lineage for d1l4sa_ (1l4s A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880111Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 880112Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (1 family) (S)
  5. 880113Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (1 protein)
  6. 880114Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species)
    Ribosome associated factor; cold-shock response protein
  7. 880115Species Escherichia coli [TaxId:562] [82712] (2 PDB entries)
  8. 880116Domain d1l4sa_: 1l4s A: [77693]

Details for d1l4sa_

PDB Entry: 1l4s (more details)

PDB Description: solution structure of ribosome associated factor y
PDB Compounds: (A:) Protein yfiA

SCOP Domain Sequences for d1l4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4sa_ d.204.1.1 (A:) Ribosome binding protein Y (YfiA homologue) {Escherichia coli [TaxId: 562]}
tmnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvl
vasgkhedmytainelinklerqlnklqhkgearraatsvkdanfveeveee

SCOP Domain Coordinates for d1l4sa_:

Click to download the PDB-style file with coordinates for d1l4sa_.
(The format of our PDB-style files is described here.)

Timeline for d1l4sa_: