| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (1 family) ![]() |
| Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (1 protein) |
| Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species) Ribosome associated factor; cold-shock response protein |
| Species Escherichia coli [TaxId:562] [82712] (2 PDB entries) |
| Domain d1l4sa_: 1l4s A: [77693] |
PDB Entry: 1l4s (more details)
SCOP Domain Sequences for d1l4sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l4sa_ d.204.1.1 (A:) Ribosome binding protein Y (YfiA homologue) {Escherichia coli [TaxId: 562]}
tmnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvl
vasgkhedmytainelinklerqlnklqhkgearraatsvkdanfveeveee
Timeline for d1l4sa_: