PDB entry 1l4s

View 1l4s on RCSB PDB site
Description: Solution structure of ribosome associated factor Y
Class: translation
Keywords: Ribosome Binding Protein
Deposited on 2002-03-05, released 2002-12-04
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yfiA
    Species: Escherichia coli
    Gene: YFIA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1l4sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l4sA (A:)
tmnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvl
vasgkhedmytainelinklerqlnklqhkgearraatsvkdanfveeveee