Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (4 proteins) |
Protein DNA polymerase I (Klenow fragment) [56674] (3 species) |
Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (42 PDB entries) |
Domain d1l3sa2: 1l3s A:469-876 [84522] Other proteins in same PDB: d1l3sa1 complexed with mg, so4, suc |
PDB Entry: 1l3s (more details), 1.7 Å
SCOP Domain Sequences for d1l3sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3sa2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
Timeline for d1l3sa2: