Lineage for d1l3sa1 (1l3s A:297-468)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1172062Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1172413Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1172488Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1172489Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (42 PDB entries)
    Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 1172495Domain d1l3sa1: 1l3s A:297-468 [84521]
    Other proteins in same PDB: d1l3sa2
    protein/DNA complex; complexed with mg, so4, suc

Details for d1l3sa1

PDB Entry: 1l3s (more details), 1.7 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1l3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3sa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d1l3sa1:

Click to download the PDB-style file with coordinates for d1l3sa1.
(The format of our PDB-style files is described here.)

Timeline for d1l3sa1: