Lineage for d1kw4a_ (1kw4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328565Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2328613Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2328650Protein Polyhomeotic [74737] (1 species)
  7. 2328651Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [74738] (2 PDB entries)
  8. 2328652Domain d1kw4a_: 1kw4 A: [73077]

Details for d1kw4a_

PDB Entry: 1kw4 (more details), 1.75 Å

PDB Description: polyhomeotic sam domain structure
PDB Compounds: (A:) Polyhomeotic

SCOPe Domain Sequences for d1kw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
drppisswsvddvsnfirelpgcqdyvddfiqqeidgqallrlkekhlvnamgmklgpal
kivakvesik

SCOPe Domain Coordinates for d1kw4a_:

Click to download the PDB-style file with coordinates for d1kw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kw4a_: