Lineage for d1ktha_ (1kth A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890511Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 890512Superfamily g.8.1: BPTI-like [57362] (3 families) (S)
  5. 890513Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 890536Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)
  7. 890537Species Human (Homo sapiens) [TaxId:9606] [57367] (6 PDB entries)
  8. 890538Domain d1ktha_: 1kth A: [68863]
    complexed with po4

Details for d1ktha_

PDB Entry: 1kth (more details), 0.95 Å

PDB Description: the anisotropic refinement of kunitz type domain c5 at 0.95 angstrom
PDB Compounds: (A:) Collagen alpha 3(VI) chain

SCOP Domain Sequences for d1ktha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]}
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv

SCOP Domain Coordinates for d1ktha_:

Click to download the PDB-style file with coordinates for d1ktha_.
(The format of our PDB-style files is described here.)

Timeline for d1ktha_: