Lineage for d1ktha_ (1kth A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143634Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)
  7. 143635Species Human (Homo sapiens) [TaxId:9606] [57367] (4 PDB entries)
  8. 143636Domain d1ktha_: 1kth A: [68863]

Details for d1ktha_

PDB Entry: 1kth (more details), 0.95 Å

PDB Description: the anisotropic refinement of kunitz type domain c5 at 0.95 angstrom

SCOP Domain Sequences for d1ktha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens)}
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv

SCOP Domain Coordinates for d1ktha_:

Click to download the PDB-style file with coordinates for d1ktha_.
(The format of our PDB-style files is described here.)

Timeline for d1ktha_: