Lineage for d1ks9a2 (1ks9 A:1-167)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
C-terminal domains also show some similarity
Protein Ketopantoate reductase PanE [69419] (1 species) Species Escherichia coli [TaxId:562] [69420] (4 PDB entries) 
Domain d1ks9a2: 1ks9 A:1-167 [68858]
Other proteins in same PDB: d1ks9a1
Details for d1ks9a2
PDB Entry: 1ks9 (more details), 1.7 Å
PDB Description: Ketopantoate Reductase from Escherichia coli
PDB Compounds: (A:) 2-dehydropantoate 2-reductaseSCOPe Domain Sequences for d1ks9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhn
SCOPe Domain Coordinates for d1ks9a2:
Click to download the PDB-style file with coordinates for d1ks9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ks9a2:
- d1ks9a2 first appeared in SCOP 1.59
- d1ks9a2 appears in SCOPe 2.06
- d1ks9a2 appears in the current release, SCOPe 2.08
View in 3D
