Lineage for d1kqla_ (1kql A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039858Superfamily h.1.5: Tropomyosin [57997] (2 families) (S)
  5. 3039859Family h.1.5.1: Tropomyosin [57998] (1 protein)
  6. 3039860Protein Tropomyosin [57999] (5 species)
  7. 3039868Species Norway rat (Rattus norvegicus) [TaxId:10116] [75697] (4 PDB entries)
  8. 3039871Domain d1kqla_: 1kql A: [72881]
    fragment fused with the yeast GCN4 leucine zipper

Details for d1kqla_

PDB Entry: 1kql (more details), 2.7 Å

PDB Description: crystal structure of the c-terminal region of striated muscle alpha- tropomyosin at 2.7 angstrom resolution
PDB Compounds: (A:) Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper

SCOPe Domain Sequences for d1kqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqla_ h.1.5.1 (A:) Tropomyosin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmts

SCOPe Domain Coordinates for d1kqla_:

Click to download the PDB-style file with coordinates for d1kqla_.
(The format of our PDB-style files is described here.)

Timeline for d1kqla_:

3039871
d1kqla_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1kqlb_