![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.5: Tropomyosin [57997] (2 families) ![]() |
![]() | Family h.1.5.1: Tropomyosin [57998] (1 protein) |
![]() | Protein Tropomyosin [57999] (5 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [75697] (4 PDB entries) |
![]() | Domain d1kqla_: 1kql A: [72881] fragment fused with the yeast GCN4 leucine zipper |
PDB Entry: 1kql (more details), 2.7 Å
SCOPe Domain Sequences for d1kqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqla_ h.1.5.1 (A:) Tropomyosin {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdkveellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmts
Timeline for d1kqla_: