| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
| Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
| Species Staphylococcus aureus [TaxId:1280] [74941] (3 PDB entries) |
| Domain d1kq1a_: 1kq1 A: [72848] complexed with acy |
PDB Entry: 1kq1 (more details), 1.55 Å
SCOPe Domain Sequences for d1kq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
Timeline for d1kq1a_: