Lineage for d1kq1a_ (1kq1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786929Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 1786930Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 1787012Species Staphylococcus aureus [TaxId:1280] [74941] (3 PDB entries)
  8. 1787013Domain d1kq1a_: 1kq1 A: [72848]
    complexed with acy

Details for d1kq1a_

PDB Entry: 1kq1 (more details), 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq
PDB Compounds: (A:) Host Factor for Q beta

SCOPe Domain Sequences for d1kq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv

SCOPe Domain Coordinates for d1kq1a_:

Click to download the PDB-style file with coordinates for d1kq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq1a_: