Lineage for d1kooa1 (1koo A:201-362)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1583934Family c.10.2.3: mRNA export factor tap [52065] (2 proteins)
    this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain
  6. 1583935Protein mRNA export factor tap [52066] (1 species)
  7. 1583936Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)
  8. 1583941Domain d1kooa1: 1koo A:201-362 [68726]
    Other proteins in same PDB: d1kooa2, d1kooc2
    mutant

Details for d1kooa1

PDB Entry: 1koo (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
PDB Compounds: (A:) tip associating protein

SCOPe Domain Sequences for d1kooa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kooa1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslcdtfrdqstyisairerfpkllrldghelpppiaf

SCOPe Domain Coordinates for d1kooa1:

Click to download the PDB-style file with coordinates for d1kooa1.
(The format of our PDB-style files is described here.)

Timeline for d1kooa1: