![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54326] (6 PDB entries) |
![]() | Domain d1kf6b2: 1kf6 B:1-105 [72398] Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6o_, d1kf6p_ complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4 |
PDB Entry: 1kf6 (more details), 2.7 Å
SCOPe Domain Sequences for d1kf6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd
Timeline for d1kf6b2: