Lineage for d1k6ya1 (1k6y A:1-46)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763368Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family) (S)
  5. 763369Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
    Zn-binding site is near the C-terminus
  6. 763370Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 763371Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries)
  8. 763372Domain d1k6ya1: 1k6y A:1-46 [68239]
    Other proteins in same PDB: d1k6ya2, d1k6yb2, d1k6yc2, d1k6yd2

Details for d1k6ya1

PDB Entry: 1k6y (more details), 2.4 Å

PDB Description: Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase
PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d1k6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6ya1 a.4.10.1 (A:1-46) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlk

SCOP Domain Coordinates for d1k6ya1:

Click to download the PDB-style file with coordinates for d1k6ya1.
(The format of our PDB-style files is described here.)

Timeline for d1k6ya1:

763372
d1k6ya1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1k6ya2