| Class b: All beta proteins [48724] (176 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins) automatically mapped to Pfam PF03145 |
| Protein SIAH, seven in absentia homolog [69199] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries) |
| Domain d1k2fa_: 1k2f A: [68054] complexed with bme, zn |
PDB Entry: 1k2f (more details), 2.6 Å
SCOPe Domain Sequences for d1k2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]}
svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh
ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli
gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn
lginvtismc
Timeline for d1k2fa_: