SCOPe 2.06: Domain d1k2fa_: 1k2f A:

Lineage for d1k2fa_ (1k2f A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
   automatically mapped to Pfam PF03145

6. Protein SIAH, seven in absentia homolog [69199] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries)

8. Domain d1k2fa_: 1k2f A: [68054]
   complexed with bme, zn

Details for d1k2fa_

PDB Entry: 1k2f, 2.6 Å

PDB Description: siah, Seven In Absentia Homolog

PDB Compounds: (A:) siah-1A protein

SCOPe Domain Sequences for d1k2fa_:

Sequence; same for both SEQRES and ATOM records:

>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]}
svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh
ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli
gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn
lginvtismc

Timeline for d1k2fa_:

• d1k2fa_ first appeared in SCOP 1.59
  
• d1k2fa_ appears in SCOPe 2.05
  
• d1k2fa_ appears in SCOPe 2.07
  
• d1k2fa_ appears in the current release, SCOPe 2.08